PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G1414
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 302aa    MW: 33584.2 Da    PI: 7.6778
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G1414genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l ++++ +G+g+W+t ++  g+ R++k+c++rw +yl
      Gh_A03G1414 14 KGPWTPEEDLKLTNYIQVHGPGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.22.9e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia  ++ gRt++++k++w+++
      Gh_A03G1414  67 RGRFSFEEEETIIQLHGILGNK-WSAIAGQLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.556961IPR017930Myb domain
SuperFamilySSF466897.26E-3111108IPR009057Homeodomain-like
SMARTSM007172.4E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001671.22E-111661No hitNo description
PROSITE profilePS5129424.19462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2565116IPR009057Homeodomain-like
SMARTSM007171.6E-1466114IPR001005SANT/Myb domain
PfamPF002493.0E-1467111IPR001005SANT/Myb domain
CDDcd001674.20E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGRTPCCDKS GLKKGPWTPE EDLKLTNYIQ VHGPGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIRRGRF SFEEEETIIQ LHGILGNKWS AIAGQLPGRT DNEIKNYWNT HIRKRLLRNG  120
IDPVTHAPRL DLLDLSSIIS STLCNQSLLN VSNLLGTQAL LNPQLLSLAN TLLSLKQENP  180
EMLMQYLQQN QLNLDPSLQA PIQTASACTT TSTVPCCTSM LSQTGLIQAS GEGFLSSDMT  240
NFSYPNSQEI LTTSTLTNEF AAQPHYVQCS TNPTVPILSE TSNFQSVDGS FDSMKLVLQD  300
KI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591741e-70AJ459174.1 Gossypium hirsutum partial myb144 gene, clone pGhMYB144.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479755.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP01e-72MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D2SKR30.0A0A0D2SKR3_G
STRINGPOPTR_0019s14070.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.17e-85myb domain protein 41